General Information

    • DRAMP ID

    • DRAMP18430

    • Peptide Name

    • Saha-CATH3 (cathelicidins; mammals, animals)

    • Source

    • Tasmanian devil, Sarcophilus harrisii

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KRMGIFHLFWAGLRKLGNLIKNKIQQGIENFLG

    • Sequence Length

    • 33

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • Active against C. neoformans (MIC 16 ug/mL).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18430 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18430.

Physicochemical Information

    • Formula

    • C179H287N51O41S

    • Absent Amino Acids

    • CDPSTVY

    • Common Amino Acids

    • GL

    • Mass

    • 3841.62

    • PI

    • 11.17

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +6

    • Boman Index

    • -3010

    • Hydrophobicity

    • -0.079

    • Aliphatic Index

    • 109.39

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 171.88

    • Polar Residues

    • 8

DRAMP18430

DRAMP18430 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cathelicidins in the Tasmanian devil (Sarcophilus harrisii).

    • Reference

    • Sci Rep. 2016 Oct 11;6:35019

    • Author

    • Peel E, Cheng Y, Djordjevic JT, Fox S, Sorrell TC, Belov K