• DRAMP ID

    • DRAMP18433
    • Peptide Name

    • Cremycin-15 (nematode; invertebrates, animals)
    • Source

    • Caenorhabditis remanei
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GSEIRGPCIDRFCRVICRNNGYESGHCNRWARGCSCASWIGR
    • Sequence Length

    • 42
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

    • Active against Gram-positive bacteria B. megaterium and S. marcescens (CL 14.1-17.7 uM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18433 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18433.
    • Formula

    • C196H306N70O57S6
    • Absent Amino Acids

    • KLMQT
    • Common Amino Acids

    • R
    • Mass

    • 4747.38
    • PI

    • 8.98
    • Basic Residues

    • 8
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +5
    • Boman Index

    • -11680
    • Hydrophobicity

    • -0.533
    • Aliphatic Index

    • 48.81
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12865
    • Absorbance 280nm

    • 313.78
    • Polar Residues

    • 20

DRAMP18433

DRAMP18433 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Nematode-derived drosomycin-type antifungal peptides provide evidence for plant-to-ecdysozoan horizontal transfer of a disease resistance gene
    • Reference

    • Nat Commun. 2014;5:3154.
    • Author

    • Zhu S, Gao B.