• DRAMP ID

    • DRAMP18434
    • Peptide Name

    • Cremycin-5 (nematode; invertebrates, animals)
    • Source

    • Caenorhabditis remanei
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • VKSGHYKGPCYHDENCNGVCRDEGYKSGHCSRWGGACWCDT
    • Sequence Length

    • 41
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18434 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18434.
    • Formula

    • C190H272N60O60S6
    • Absent Amino Acids

    • FILMQ
    • Common Amino Acids

    • G
    • Mass

    • 4566.99
    • PI

    • 6.95
    • Basic Residues

    • 8
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +3
    • Boman Index

    • -9791
    • Hydrophobicity

    • -1.019
    • Aliphatic Index

    • 16.19
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 15845
    • Absorbance 280nm

    • 386.46
    • Polar Residues

    • 22

DRAMP18434

DRAMP18434 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Nematode-derived drosomycin-type antifungal peptides provide evidence for plant-to-ecdysozoan horizontal transfer of a disease resistance gene
    • Reference

    • Nat Commun. 2014;5:3154.
    • Author

    • Zhu S, Gao B.