General Information

    • DRAMP ID

    • DRAMP18436

    • Peptide Name

    • AtPDF2.3 (flowering plants)

    • Source

    • Arabidopsis thaliana

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • Active against S. cerevisiae.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18436 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18436.

Physicochemical Information

    • Formula

    • C217H340N82O61S8

    • Absent Amino Acids

    • DILMQW

    • Common Amino Acids

    • C

    • Mass

    • 5348.1

    • PI

    • 9.49

    • Basic Residues

    • 14

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +12

    • Boman Index

    • -15661

    • Hydrophobicity

    • -0.931

    • Aliphatic Index

    • 14.17

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 42.34

    • Polar Residues

    • 24

DRAMP18436

DRAMP18436 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The antifungal plant defensin AtPDF2.3 from Arabidopsis thaliana blocks potassium channels.

    • Reference

    • Sci Rep. 2016 Aug 30;6:32121.

    • Author

    • Vriens K, Peigneur S, De Coninck B, Tytgat J, Cammue BP, Thevissen K.