General Information

    • DRAMP ID

    • DRAMP18442

    • Peptide Name

    • Smp43 (scorpions, arachnids, Chelicerata, arthropods, invertebrates, animals)

    • Source

    • venom, Scorpio maurus palmatus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GVWDWIKKTAGKIWNSEPVKALKSQALNAAKNFVAEKIGATPS

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • Active against B. subtilis NCIMB 8024 (MIC 4 ug/ml), S. epidermidis sp., S. aureus SH100 (MIC 32-64 ug/ml), E. coli JM109, K. pneumoniae NCTC 13439, and C. albicans (MIC 64-128 ug/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrance

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18442 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18442.

Physicochemical Information

    • Formula

    • C214H339N57O59

    • Absent Amino Acids

    • CHMRY

    • Common Amino Acids

    • AK

    • Mass

    • 4654.39

    • PI

    • 9.88

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +4

    • Boman Index

    • -3981

    • Hydrophobicity

    • -0.316

    • Aliphatic Index

    • 81.86

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16500

    • Absorbance 280nm

    • 392.86

    • Polar Residues

    • 11

DRAMP18442

DRAMP18442 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterisation of three alpha-helical antimicrobial peptides from the venom of Scorpio maurus palmatus

    • Reference

    • Toxicon. 2016 Jul;117:30-6.

    • Author

    • Harrison PL, Abdel-Rahman MA, Strong PN, Tawfik MM, Miller K.