General Information

    • DRAMP ID

    • DRAMP18448

    • Peptide Name

    • Diapausin-1 (insects, arthropods, invertebrates, animals)

    • Source

    • hemolymph, tobacco hornworm, Manduca sexta

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • INNWVRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGGMNCYRR

    • Sequence Length

    • 45

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18448 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18448.

Physicochemical Information

    • Formula

    • C212H322N76O62S7

    • Absent Amino Acids

    • LT

    • Common Amino Acids

    • C

    • Mass

    • 5169.8

    • PI

    • 8.35

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -13490

    • Hydrophobicity

    • -0.909

    • Aliphatic Index

    • 33.91

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 163.67

    • Polar Residues

    • 17

DRAMP18448

DRAMP18448 chydropathy plot

Comments Information

    • Fuction

    • Active against FUNGI such as S. cerevisiae (IC50 12 uM) but not bacteria. The peptide is inducible since mRNA level in fact body increased after yeast challege of larvae.

Literature Information

  • ·Literature 1

    • Title

    • Characterization and regulation of expression of an antifungal peptide from hemolymph of an insect, Manduca sexta.

    • Reference

    • Dev Comp Immunol. 2016 Aug;61:258-68.

    • Author

    • Al Souhail Q, Hiromasa Y, Rahnamaeian M, Giraldo MC, Takahashi D, Valent B, Vilcinskas A, Kanost MR.