General Information

    • DRAMP ID

    • DRAMP18491

    • Peptide Name

    • CecropinXJ (Insects, arthropods, invertebrates, animals)

    • Source

    • Bombyx mori

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-cancer

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus (MIC= 1.81

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18491 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C185H317N55O46S

    • Absent Amino Acids

    • CHQTY

    • Common Amino Acids

    • K

    • Mass

    • 4079.95

    • PI

    • 10.71

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +7

    • Boman Index

    • -5387

    • Hydrophobicity

    • -0.243

    • Aliphatic Index

    • 100.27

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 152.78

    • Polar Residues

    • 7

DRAMP18491

DRAMP18491 chydropathy plot

Comments Information

    • Function

    • Antimicrobial activity against Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Expression, purification and characterization of cecropin antibacterial peptide from Bombyx mori in Saccharomyces cerevisiae.

    • Reference

    • Protein Expr Purif. 2013 Jul;90(1):47-54.

    • Author

    • Xia L, Liu Z, Ma J, Sun S, Yang J, Zhang F.