General Information

    • DRAMP ID

    • DRAMP18509

    • Peptide Name

    • Px-cec1 (cecropin1 peptide derivative)

    • Source

    • Diamondback moth(Plutella xylostella)

    • Family

    • Derived from the cecropin1

    • Gene

    • cecropin1

    • Sequence

    • MAFKKLEKVGRNIRDGIIKAGPAVAVIGQATSIARPTGK

    • Sequence Length

    • 39

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anitifungal

    • Target Organism

      • [Ref.22921836]Gram-positive bacteria: Staphylococcus aureus (MIC=2.1 μg/mL), Bacillus cereus (MIC=2.6 μg/mL);
      • Gram-negative bacteria: Escherichia coli K12D31 (MIC=0.1 μg/mL), Escherichia coli K12 (MIC=0.23 μg/mL), Pseudomonas fluorescent (MIC=1.1 μg/mL), Salmonella choleraesuis (MIC=2.1 μg/mL);
      • Fungi: Aureobasidium pullulans (MIC=4.0 μg/mL), Aspergillus flavus (MIC=14.5 μg/mL), Aspergillus fumigatus (MIC=16.0 μg/mL), Aspergillus niger (MIC=14.6 μg/mL), Fusarium oxysporum (MIC=8.0 μg/mL)

    • Hemolytic Activity

      • [Ref.22921836]Non-hemolytic against human red blood cells.

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18509 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18509.

Physicochemical Information

    • Formula

    • C180H313N55O49S

    • Absent Amino Acids

    • CHWY

    • Common Amino Acids

    • A

    • Mass

    • 4063.86

    • PI

    • 11.12

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +6

    • Boman Index

    • -4623

    • Hydrophobicity

    • 0

    • Aliphatic Index

    • 97.69

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 9

DRAMP18509

DRAMP18509 chydropathy plot

Comments Information

    • Function

    • Antimicrobial activity against Gram-positive, Gram-negative bacteria and fungi. No hemolytic activity.

Literature Information

  • ·Literature 1

    • Title

    • cDNA cloning and characterization of the antibacterial peptide cecropin 1 from the diamondback moth, Plutella xylostella L.

    • Reference

    • Protein Expr Purif. 2012 Oct;85(2):230-8.

    • Author

    • Jin F, Sun Q, Xu X, Li L, Gao G, Xu Y, Yu X, Ren S.