• DRAMP ID

    • DRAMP18703
    • Peptide Name

    • Pleurain-G1 (Frogs, amphibians, animals)
    • Source

    • Rana pleuraden (Yunnan pond frog)
    • Family

    • Belongs to the frog skin active peptide (FSAP) family. Pleurain subfamily.
    • Gene

    • Not found
    • Sequence

    • GFWDSVKEGLKNAAVTILNKIKCKISECPPA
    • Sequence Length

    • 31
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • [Ref.19028675]Gram-negative bacterium: Escherichia coli (MIC=50 μg/ml);
      • Gram-positive bacteria: Staphylococcus aureus (MIC=50 μg/ml), Bacillus subtilis (MIC=100 μg/ml);
      • Yeast: Candida albicans(MIC=12.5 μg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18703 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18703.
    • Formula

    • C151H247N39O43S2
    • Absent Amino Acids

    • HMQRY
    • Common Amino Acids

    • K
    • Mass

    • 3360.98
    • PI

    • 8.79
    • Basic Residues

    • 5
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +2
    • Boman Index

    • -2488
    • Hydrophobicity

    • -0.048
    • Aliphatic Index

    • 91.29
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5625
    • Absorbance 280nm

    • 187.5
    • Polar Residues

    • 9

DRAMP18703

DRAMP18703 chydropathy plot
    • Function

    • Antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria and fungi.
  • ·Literature 1
    • Title

    • Antioxidant peptidomics reveals novel skin antioxidant system.
    • Reference

    • Mol Cell Proteomics. 2009 Mar;8(3):571-83.
    • Author

    • Yang H, Wang X, Liu X, Wu J, Liu C, Gong W, Zhao Z, Hong J, Lin D, Wang Y, Lai R.