• • DRAMP ID

  • DRAMP18717

• • Peptide Name

  • Charybdotoxin (Yellow scorpions, arachnids, Chelicerata, arthropods, invertebrates, animals)

• • Source

  • Leiurus quinquestriatus hebraeus

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

• • Sequence Length

  • 37

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • [Ref.15118082]Gram-positive bacteria: Bacillus subtilis (Inhibition zone=4 mm completely inhibit in PH5.5, Inhibition zone=7 mm incompletely inhibit and Inhibition zone=6 mm in PH7.5 completely inhibit at 10 μg/well), Staphylococcus aureus (Inhibition zone=3 mm incompletely inhibit in PH5.5, Inhibition zone=6 mm incompletely inhibit and Inhibition zone=1 mm completely inhibit in PH7.5 at 10 μg/well);
    • Gram-negative bacteria: Escherichia coli (Inhibition zone=2 mm incompletely inhibit in PH5.5, Inhibition zone=8 mm incompletely inhibit in PH7.5 at 10 μg/well);
    • Fungi: Candida albicans (Inhibition zone=13 mm completely inhibit in PH5.5, Inhibition zone=15 mm in PH7.5 completely inhibit at 10 μg/well).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Combine Helix and Beta structure

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 2CRD resolved by NMR

• Predicted Structure

• There is no predicted structure for DRAMP18717.

DRAMP18717

• • Function

  • Antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria and fungi.

• ·Literature 1

• • Title

  • Multidimensional signatures in antimicrobial peptides.

• • Pubmed ID

  • 15118082

• • Reference

  • Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-8.

• • Author

  • Yount NY, Yeaman MR.