• DRAMP ID

    • DRAMP20763
    • Peptide Name

    • Halocin C8 (HalC8, Halocin-C8; Microhalocins, Archaeocin, Bacteriocin, Archaea, Euryarchaeota, Prokaryotes)
    • Source

    • Halobacterium sp. (strain AS7092)
    • Family

    • Unknown
    • Gene

    • proC8
    • Sequence

    • DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSCLGFVEIVCTVADEYSGCGDAVAKEACNRAGLC
    • Sequence Length

    • 76
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknownn
    • DRAMP20763 helical wheel diagram
    • Formula

    • C316H511N83O103S10
    • Absent Amino Acids

    • HMW
    • Common Amino Acids

    • GA
    • Mass

    • 7441.63
    • PI

    • 4.14
    • Basic Residues

    • 3
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 32
    • Boman Index

    • -0.2
    • Hydrophobicity

    • 0.89
    • Aliphatic Index

    • 98.95
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3605
    • Absorbance 280nm

    • 48.07
    • Polar Residues

    • 34

DRAMP20763

DRAMP20763 chydropathy plot
    • Function

    • Antibacterial activity against a wide variety of haloarchaeons. Causes cell lysis and death, possibly by disrupting the cell wall. Immunity protein HalI
    • Miscellaneous

    • Is quite robust, as it can be desalted, boiled, subjected to organic solvents, and stored at 4 degrees Celsius for extended periods without losing activity.
    • Induction

    • Increases to maximal levels upon transition from exponential to stationary phase.
  • Literature 1
    • Reference

    • Extremophiles. 2003 Oct;7(5):401-7.
    • Author

    • Li Y, Xiang H, Liu J, Zhou M, Tan H.
    • Title

    • Purification and biological characterization of halocin C8, a novel peptide antibiotic from Halobacterium strain AS7092.