General Information

    • DRAMP ID

    • DRAMP20765

    • Peptide Name

    • Halocin A4 (HalA4, Halocin-A4, Halocin U1; Microhalocins, Archaeocin, Bacteriocin, Archaea, Euryarchaeota, Prokaryotes)

    • Source

    • Haloarchaeon strain TuA4

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSSLGFFVITCTTSADYYSIPDSNAAK

    • Sequence Length

    • 68

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

      • [Ref.11114928] Archaea: Sulfolobus solfataricus (Inhibition Zone=12mm)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20765 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20765.

Physicochemical Information

    • Formula

    • C296H466N72O95S6

    • Absent Amino Acids

    • EHMRW

    • Common Amino Acids

    • AGI

    • Mass

    • 6745.74

    • PI

    • 4.14

    • Basic Residues

    • 2

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 29

    • Net Charge

    • -2

    • Boman Index

    • -0.22

    • Hydrophobicity

    • 0.008

    • Aliphatic Index

    • 94.85

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 72.31

    • Polar Residues

    • 33

DRAMP20765

DRAMP20765 chydropathy plot

Comments Information

    • Function

    • TuA4 cell lysates are not toxic for S. solfataricus, and protease (but not nuclease) treatment of the halocin A4 preparation inactivated toxicity, indicating that the A4 toxic factor must be a secreted protein.

Literature Information

  • ·Literature 1

    • Title

    • Secreted euryarchaeal microhalocins kill hyperthermophilic crenarchaea.

    • Reference

    • J Bacteriol. 2001 Jan;183(1):287-91.

    • Author

    • Haseltine C, Hill T, Montalvo-Rodriguez R, Kemper SK, Shand RF, Blum P.