General Information

    • DRAMP ID

    • DRAMP20767

    • Peptide Name

    • Pore-forming peptide ameobapore B (Parasite, amoebozoa, protozoa, protists)

    • Source

    • Entamoeba histolytica

    • Family

    • Belongs to the amoebapore (amoebapore) family

    • Gene

    • Not found

    • Sequence

    • GAILCNLCKDTVKLVENLLTVDGAQAVRQYIDNLCGKASGFLGTLCEKILSFGVDELVKLIENHVDPVVVCEKIHAC

    • Sequence Length

    • 77

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antibiotic

    • Target Organism

      • [Ref.7715451] Gram-positive bacterium: Micrococcus luteus (MIC=5 μM, MBC=5 μM)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys77, Cys8 and Cys71, Cys35 and Cys46

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20767 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20767.

Physicochemical Information

    • Formula

    • C366H604N96O110S6

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • LV

    • Mass

    • 8301.76

    • PI

    • 5.14

    • Basic Residues

    • 9

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 33

    • Net Charge

    • -1

    • Boman Index

    • -4003

    • Hydrophobicity

    • 0.475

    • Aliphatic Index

    • 125.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 24.54

    • Polar Residues

    • 22

DRAMP20767

DRAMP20767 chydropathy plot

Comments Information

    • Function

    • Forms pores in the cytoplasmic membrane of host cells. Has antibacterial activity against M.luteus, no activity against E.coli. Implicated in the cytolytic activity of the parasite.

Literature Information

  • ·Literature 1

    • Title

    • Amoebapores, a family of membranolytic peptides from cytoplasmic granules of Entamoeba histolytica: isolation, primary structure, and pore formation in bacterial cytoplasmic membranes.

    • Reference

    • Mol Microbiol. 1994 Dec;14(5):895-904.

    • Author

    • Leippe M, Andrä J, Nickel R, Tannich E, Müller-Eberhard HJ.