• DRAMP ID

    • DRAMP20770
    • Peptide Name

    • Naegleriapore B (NP-B; parasite, amoebozoa, protozoa, protists)
    • Source

    • Naegleria fowleri (Brain eating amoeba)
    • Family

    • Not found
    • Gene

    • NP-B
    • Sequence

    • SVIGCEICEWLVATAEGFVNKTKPQIEQELLQICAKLGPYEQICDQLVLMELPDIIDQIIAKEPPAIVCSQVKICNGSAMAVAA
    • Sequence Length

    • 84
    • Protein Existence

    • Protein predicted
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP20770 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP20770.
    • Formula

    • C402H659N99O122S8
    • Absent Amino Acids

    • HR
    • Common Amino Acids

    • I
    • Mass

    • 9087.72
    • PI

    • 4.29
    • Basic Residues

    • 5
    • Acidic Residues

    • 11
    • Hydrophobic Residues

    • 36
    • Net Charge

    • -6
    • Boman Index

    • -2135
    • Hydrophobicity

    • 0.455
    • Aliphatic Index

    • 118.45
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 88.73
    • Polar Residues

    • 18

DRAMP20770

DRAMP20770 chydropathy plot
    • No comments found on DRAMP database

  • ·Literature 1
    • Title

    • Pore-forming polypeptides of the pathogenic protozoon Naegleria fowleri.
    • Reference

    • J Biol Chem. 2002 Jun 21;277(25):22353-60.
    • Author

    • Herbst R, Ott C, Jacobs T, Marti T, Marciano-Cabral F, Leippe M.