General Information

    • DRAMP ID

    • DRAMP20829

    • Peptide Name

    • ABP-dHC-Cecropin A

    • Source

    • Synthetic construct

    • Family

    • Derived from dHC

    • Gene

    • Not found

    • Sequence

    • RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Anti-Cancer

    • Target Organism

      • [Ref.28347740] Cancer cell lines: Leukemia cell lines K562 (IC50=349.5μM), Leukemia cell lines U937 (IC50=303.2μM), Leukemia cell lines THP-1 (IC50=228.5μM)

    • Hemolytic Activity

      • [Ref.28347740] 0% hemolysis at 0μM, 1% hemolysis at 800μM against human red cells

    • Cytotoxicity

      • [Ref.28347740] IC50 = 349.5 μM and CI = [304.0, 399.0] μM against K562 cells.
      • IC50 = 303.2 μM and CI =[291.2, 315.3] μM against U937 cells. IC50 = 228.5 μM and CI = [199.1, 258.0] μM against THP-1 cells. The CI is the Confidence Interval of 90%.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • ABP-dHC-Cecropin A and its analog adopt a well-defined

    • Helical Wheel Diagram

    • DRAMP20829 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20829.

Physicochemical Information

    • Formula

    • C185H316N56O46

    • Absent Amino Acids

    • CHMSY

    • Common Amino Acids

    • K

    • Mass

    • 4060.89

    • PI

    • 11.17

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +7

    • Boman Index

    • -5007

    • Hydrophobicity

    • -0.187

    • Aliphatic Index

    • 108.11

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 152.78

    • Polar Residues

    • 7

DRAMP20829

DRAMP20829 chydropathy plot

Comments Information

    • Function

    • Anticancer activity against the human leukemia cells

Literature Information

  • ·Literature 1

    • Title

    • Selective cytotoxicity of the antibacterial peptide ABP-dHC-Cecropin A and its analog towards leukemia cells

    • Reference

    • Eur J Pharmacol. 2017 May 15;803:138-147.

    • Author

    • Sang M, Zhang J, Zhuge Q