General Information

    • DRAMP ID

    • DRAMP20878

    • Peptide Name

    • rVpDef

    • Source

    • Synthetic construct

    • Family

    • Derived from VpDef

    • Gene

    • ATGGGTTTTGGTTGTCCAGA

    • Sequence

    • MGFGCPEDEYECHNHCKNSVGCRGGYCDAGTLRQRCTCYGCNQKGRSIQE

    • Sequence Length

    • 50

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.29524591] Gram-positive bacteria: Listeria monocytogenes ATCC 21633 (MIC=75 μg/ml), Bacillu subtilis Lzz-133 (MIC=95 μg/ml), Staphylococcus aureus ATCC 25923 (MIC=120 μg/ml);
      • Gram-negative bacteria: Escherichia coli O157 ATCC 35150 (MIC=50 μg/ml), Eschericha coli ATCC 10305 (MIC=75 μg/ml), Salmonella enterica ATCC 10467 (MIC=120 μg/ml)

    • Hemolytic Activity

      • [Ref.29524591] 0% haemolysis at 30 μg/ml, 0% haemolysis at 60 μg/ml, 0% haemolysis at 90 μg/ml, 0% haemolysis at 115 μg/ml, 0.2% haemolysis at 145 μg/ml, 1.5% haemolysis at 175 μg/ml against rabbit red blood cells

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20878 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20878.

Physicochemical Information

    • Formula

    • C223H344N74O76S9

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • CG

    • Mass

    • 5566.17

    • PI

    • 6.68

    • Basic Residues

    • 8

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +2

    • Boman Index

    • -13490

    • Hydrophobicity

    • -0.938

    • Aliphatic Index

    • 23.4

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 101.43

    • Polar Residues

    • 26

DRAMP20878

DRAMP20878 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against the Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Efficient production of a recombinant Venerupis philippinarum defensin (VpDef) in Pichia pastoris and characterization of its antibacterial activity and stability.

    • Reference

    • Protein Expr Purif. 2018 Jul;147:78-84.

    • Author

    • Meng DM, Lv YJ, Zhao JF, Liu QY, Shi LY, Wang JP, Yang YH, Fan ZC.