• • DRAMP ID

  • DRAMP20879

• • Peptide Name

  • DAN1

• • Source

  • Danaus plexippus (monarch butterfly)

• • Family

  • Belongs to the cecropin family.

• • Gene

  • KGM_210268

• • Sequence

  • KWKIFKKIEKVGRNVRDGIIKAGPAVQVVGQATSIAK

• • Sequence Length

  • 37

• • UniProt Entry

  • A0A212EJN7

• • Protein Existence

  • Transcript level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • [Ref.29501691] Gram-positive bacteria: Bacillus subtilis (MIC=131.3μ±μ46.1 μg/mL);
    • Gram-negative bacteria: Escherichia coli (MIC=4.9μ±μ2.3 μg/mL), Pseudomonas aeruginosa (MIC=7μ±μ0.8 μg/mL), Klebsiella pneumoniae (MIC=16.2μ±μ1.9 μg/mL)

• • Hemolytic Activity

  • • [Ref.29501691] 0% haemolysis at 10 μg/ml, 0% haemolysis at 25 μg/ml, 0% haemolysis at 50 μg/ml, 0% haemolysis at 100 μg/ml, 0% haemolysis at 200 μg/ml against sheep red blood cells

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Amidation

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Random coil

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP20879.

DRAMP20879

• • Function

  • Antibacterial activity against the Gram-positive and Gram-negative bacteria.

• ·Literature 1

• • Title

  • Identification and screening of potent antimicrobial peptides in arthropod genomes.

• • Pubmed ID

  • 29501691

• • Reference

  • Peptides. 2018 May;103:26-30. doi: 10.1016/j.peptides.2018.01.017.

• • Author

  • Duwadi D, Shrestha A, Yilma B, Kozlovski I, Sa-Eed M, Dahal N, Jukosky J.