General Information

    • DRAMP ID

    • DRAMP21259

    • Peptide Name

    • Scolopendin 1 (Centipedes, Arthropoda, Animals)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MDSFQKIEKIGEGTYGVVYKAKDKVSGRLVALKKIRLENESEGVPSTA

    • Sequence Length

    • 48

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic form

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • [Ref.25209888] Gram-positive bacteria : Staphylococcus aureus ATCC 25923(MIC=5.0 ± 4.3 μM), Enterococcus faecium ATCC 19434(MIC=10.0 ± 8.7 μM);
      • Gram-negative bacteria : Escherichia coli O-157 ATCC 43895(MIC=5.0 ± 4.3 μM), Pseudomonas aeruginosa ATCC 27853(MIC= 5.0 ± 4.3 μM);
      • Fungi : Candida albicans ATCC 90028(MIC=10.0 ± 8.7 μM), Candida parapsilosis ATCC 22019(MIC= 10.0 ± 8.7 μM), Trichosporon beigelii KCTC 7707(MIC=20.0 ± 17.3 μM)

    • Hemolytic Activity

      • [Ref.25209888] 0% hemolysis at 80 μM against human red blood cells

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Amidation

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP21259 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP21259.

Physicochemical Information

    • Formula

    • C233H387N63O73S

    • Absent Amino Acids

    • CHW

    • Common Amino Acids

    • K

    • Mass

    • 5271.07

    • PI

    • 9.1

    • Basic Residues

    • 9

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +2

    • Boman Index

    • -8620

    • Hydrophobicity

    • -0.471

    • Aliphatic Index

    • 85.21

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 63.4

    • Polar Residues

    • 14

DRAMP21259

DRAMP21259 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against Gram-positive bacteria and Gram-negative bacteria. Antifungal activity against Candida albicans, Candida parapsilosis, Trichosporon beigelii

Literature Information

  • ·Literature 1

    • Title

    • Identification of a novel antimicrobial peptide, scolopendin 1, derived from centipede Scolopendra subspinipes mutilans and its antifungal mechanism.

    • Reference

    • Insect Mol Biol. 2014 Dec;23(6):788-99. doi: 10.1111/imb.12124.

    • Author

    • Choi H, Hwang JS, Lee DG