• • DRAMP ID

  • DRAMP21414

• • Peptide Name

  • CecB Q53 (Derived from CecB E53)

• • Source

  • synthetic construct

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • RWKIFKKIEKMGRNIRDGIVKAGPAIQVLGSAKAI

• • Sequence Length

  • 35

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Synthetic form

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • [Ref.31045339] Gram-positive bacteria: Staphylococcus aureus ATCC BAA-44(MIC>20μM), Staphylococcus epidermidis ATCC 700565(MIC=8μM);
    • Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=0.15μM), Pseudomonas aeruginosa ATCC 27853(MIC=2.2μM), Pseudomonas aeruginosa ATCC 25668(MIC=2.2μM);
    • Fungi:Candida albicans ATCC 1023(MIC>20μM)

• • Hemolytic Activity

  • • [Ref.31045339] 0.1% hemolysis at 20μM, 0.5% hemolysis at 30μM, 0.5% hemolysis at 200μM against human red blood cells

• • Cytotoxicity

  • • [Ref.31045339] ①The cell viability of Hela cells induced by CecB Q53 is 102.6%, 104.0%, 99.1% and 95.6% at peptide concentrations of 10, 20, 30 and 200 μM. ②The cell viability of CCD cells induced by CecB Q53 is 108.4%, 111.5%, 108.8% and 88.5% at peptide concentrations of 10, 20, 30 and 200 μM.

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Amidation

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Random coil in aqueous solution and amphipathic helix upon interaction with cell membranes

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP21414.

DRAMP21414

• • Function

  • Antibacterial activity against Gram-positive bacteria and Gram-nagetive bacteria. Antifungal activity against Candida albicans ATCC 1023.

• ·Literature 1

• • Title

  • Enhanced Silkworm Cecropin B Antimicrobial Activity against Pseudomonas aeruginosa from Single Amino Acid Variation.

• • Pubmed ID

  • 31045339

• • Reference

  • ACS Infect Dis. 2019 May 10. doi: 10.1021/acsinfecdis.9b00042.

• • Author

  • Romoli O, Mukherjee S, Mohid SA, Dutta A, Montali A, Franzolin E, Brady D, Zito F, Bergantino E, Rampazzo C, Tettamanti G, Bhunia A, Sandrelli F