General Information

    • DRAMP ID

    • DRAMP21453

    • Peptide Name

    • Hybrid (Derived from Melittin and thanatin)

    • Source

    • synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLPLLISWIKRKRQQGSKKPVPIIYCNRRTGKCQRM

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic form

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.30701481] Gram-positive bacteria:Staphylococcus aureus(MIC=0.9-1.5μmol/L), Bacillus subtilis(MIC=0.6-1.2μmol/L);
      • Gram-negative bacteria:Escherichia coli JM 109(MIC=0.6-1.2 μmol/L), Salmonella typhimurium(MIC=0.3-0.6μmol/L)

    • Hemolytic Activity

      • [Ref.30701481] 0% hemolysis at 45 μmol/L and >0% hemolysis at 60 μmol/L against sheep blood cells

    • Cytotoxicity

      • [Ref.30701481] The average inhibitory rate of the hybrid peptide in the SMMC-7721 cells was 19.14%.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • A combination of α-helix and β-lamellar

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP21453 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP21453.

Physicochemical Information

    • Formula

    • C188H323N61O45S3

    • Absent Amino Acids

    • ADEFH

    • Common Amino Acids

    • KR

    • Mass

    • 4254.19

    • PI

    • 11.5

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +10

    • Boman Index

    • -8658

    • Hydrophobicity

    • -0.722

    • Aliphatic Index

    • 83.89

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 203.29

    • Polar Residues

    • 10

DRAMP21453

DRAMP21453 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against Gram-positive bacteria and Gram-nagetive bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Design and activity study of a melittin–thanatin hybrid peptide

    • Reference

    • AMB Express. 2019; 9: 14. Published online 2019 Jan 30. doi: 10.1186/s13568-019-0739-z

    • Author

    • Xiaofeng Jiang, Kun Qian, Guangping Liu, Laiyu Sun, Guoqing Zhou, Jingfen Li, Xinqiang Fang, Haixia Ge, Zhengbing Lv