General Information

    • DRAMP ID

    • DRAMP29089

    • Peptide Name

    • NCR044 (Putative Late nodulin)

    • Source

    • Medicago truncatula (Barrel medic) (Medicago tribuloides)

    • Family

    • Not found

    • Gene

    • MtrunA17_Chr7g021623

    • Sequence

    • AFIQLSKPCISDKECSIVKNYRARCRKGYCVRRRIR

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • [Ref.32571919] Fungi: Botrytis cinerea (IC50 = 1.55 ± 0.21 μM, IC90 = 2.72 ± 0.05 μM), Fusarium graminearum (IC50 = 1.93 ± 0.23 μM, IC90 = 2.80 ± 0.04 μM), F.virguliforme (IC50 = 1.68 ± 0.20 μM, IC90 = 2.70 ± 0.08 μM), F.oxysporum (IC50 = 0.52 ± 0.01 μM, IC90 = 0.71 ± 0.01 μM)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not found

    • Binding Target

    • Multiple membrane phospholipids

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are two disulfide bond between Cys15 and Cys25, Cys9 and Cys30

    • Stereochemistry

    • L

    • Structure

    • α-helix and β-sheet

    • Structure Description

    • NCR044 contains one short (A23 to R25, G28 to C30) antiparallel β-sheet and a whiff (S11 to E14) of an α-helix.

    • Helical Wheel Diagram

    • DRAMP29089 helical wheel diagram
  • 6U6G-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP29089.

Physicochemical Information

    • Formula

    • C185H315N63O48S4

    • Absent Amino Acids

    • HMTW

    • Common Amino Acids

    • R

    • Mass

    • 4318.17

    • PI

    • 10.32

    • Basic Residues

    • 11

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +9

    • Boman Index

    • -11949

    • Hydrophobicity

    • -0.597

    • Aliphatic Index

    • 75.83

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3230

    • Absorbance 280nm

    • 92.29

    • Polar Residues

    • 11

DRAMP29089

DRAMP29089 chydropathy plot

Comments Information

    • Comment

    • The oxidized form of the NCR044 peptide exhibits potent broad-spectrum antifungal activity in vitro against four economically important fungal pathogens tested in this study. Many factors can strongly affect the efficacy of antifungal peptides. For example, disulfide bonds can help to increase potency of the oxidized form of NCR044. For deployment of NCR044 in crop protection, one could envisage further manipulating the cationicity/hydrophobicity of the oxidized or reduced NCR044 through site-directed mutagenesis and increase its antifungal potency on the surface of plant tissues without causing phytotoxicity.

Literature Information

  • ·Literature 1

    • Title

    • Antifungal symbiotic peptide NCR044 exhibits unique structure and multifaceted mechanisms of action that confer plant protection

    • Reference

    • Proc Natl Acad Sci U S A. 2020 Jul 7;117(27):16043-16054. doi: 10.1073/pnas.2003526117. Epub 2020 Jun 22.

    • Author

    • Velivelli SLS, Czymmek KJ, Li H, Shaw JB, Buchko GW, Shah DM