• • DRAMP ID

  • DRAMP29094

• • Peptide Name

  • Turgencin A

• • Source

  • Synoicum turgens

• • Family

  • Not found

• • Gene

  • N/A

• • Sequence

  • GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV

• • Sequence Length

  • 36

• • UniProt Entry

  • C0HLN5

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial,Anti-Gram+, Anti-Gram-,Anti-cancer

• • Target Organism

  • • [Ref.32751755]Gram-positive bacteria:Bacillus megaterium(MIC=0.5 µg/mL); Bacillus subtilis(MIC=1.5 µg/mL); Corynebacterium glutamicum(MIC=1.5 µg/mL); Micrococcus luteus(MIC=8.0 µg/mL); Staphylococcus aureus(MIC=23.3 µg/mL);
    • Gram-negative bacteria:Escherichia coli(MIC=3.0 µg/mL); Pseudomonas aeruginosa(MIC=5.9 µg/mL);
    • Fungi: Rhodotorula sp(MIC=23.2 µg/mL);Aurobasidium pollulans(MIC=92.6 µg/mL); Candida albicans(MIC=46.3 µg/mL).
    • [Ref.31940927]Cancer:Human melanoma A2058(IC50=1.4 μM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • [Ref.31940927]Cytotoxicity: Human fibroblasts MRC-5(IC50=4.8 μM).

• • Binding Target

  • liposomes

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Amidation

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bond between Cys8 and Cys33, Cys12 and Cys29, Cys17 and Cys26; the 'Met' at position 10 is Methionine sulfoxide.

• • Stereochemistry

  • L

• • Structure

  • Random coil

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP29094.

DRAMP29094

• • Function

  • Antibacterial activity against Gram-positive bacteria and Gram-negative bacteria.

• ·Literature 1

• • Title

  • Antimicrobial Activity of Small Synthetic Peptides Based on the Marine Peptide Turgencin A: Prediction of Antimicrobial Peptide Sequences in a Natural Peptide and Strategy for Optimization of Potency.

• • Pubmed ID

  • 32751755

• • Reference

  • Int J Mol Sci.2020 Jul 30;21(15):5460.

• • Author

  • Hansen IKØ, Lövdahl T, Simonovic D, Hansen KØ, Andersen AJC, Devold H, Richard CSM, Andersen JH, Strøm MB, Haug T.

• ·Literature 2

• • Title

  • Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens.

• • Pubmed ID

  • 31940927

• • Reference

  • Mar Drugs. 2020 Jan 12;18(1):51.

• • Author

  • Hansen IKØ, Isaksson J, Poth AG, Hansen KØ, Andersen AJC, Richard CSM, Blencke HM, Stensvåg K, Craik DJ, Haug T.