• • DRAMP ID

  • DRAMP29095

• • Peptide Name

  • Turgencin B

• • Source

  • Synoicum turgens

• • Family

  • Not found

• • Gene

  • N/A

• • Sequence

  • GIKEMLCNMACAQTVCKKSGGPLCDTCQAACKALG

• • Sequence Length

  • 35

• • UniProt Entry

  • C0HLN6

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial,Anti-Gram+, Anti-Gram-,Anti-cancer

• • Target Organism

  • • [Ref.31940927]Gram-positive bacteria:Corynebacterium glutamicum ATCC 13032(MIC=1.6 µM);Bacillus subtilis ATCC 23857(MIC=1.6 µM);Staphylococcus aureus ATCC 9144(MIC>100µM);
    • Gram-negative bacteria:Escherichia coli ATCC 25922(MIC=12.5 µM);Pseudomonas aeruginosa ATCC 27853(MIC=25.0 µM);
    • Cancer:Human melanoma A2058(IC50=4.1 μM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • [Ref.31940927]Cytotoxicity: Human fibroblasts MRC-5(IC50=7.5 μM).

• • Binding Target

  • liposomes

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Amidation

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bond between Cys7 and Cys31, Cys11 and Cys27, Cys16 and Cys24; the 'Met' at position 5 and 9 is Methionine sulfoxide.

• • Stereochemistry

  • L

• • Structure

  • Alpha helix,random coil

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP29095.

DRAMP29095

• • Function

  • Antibacterial activity against Gram-positive bacteria and Gram-negative bacteria.

• ·Literature 1

• • Title

• • Pubmed ID

  • 31940927

• • Reference

  • Mar Drugs. 2020 Jan 12;18(1):51.

• • Author

  • Hansen IKØ, Isaksson J, Poth AG, Hansen KØ, Andersen AJC, Richard CSM, Blencke HM, Stensvåg K, Craik DJ, Haug T.