• • DRAMP ID

  • DRAMP29099

• • Peptide Name

  • CAP18

• • Source

  • Oryctolagus cuniculus

• • Family

  • Not found

• • Gene

  • camp

• • Sequence

  • GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY

• • Sequence Length

  • 37

• • UniProt Entry

  • G1T9L4

• • Protein Existence

  • Homology

• • Biological Activity

  • Antimicrobial, Antibacterial,Anti-Gram+,Anti-Gram-

• • Target Organism

  • • [Ref.11557478]Gram-negative bacteria:Pseudomonas aeruginosa(MIC=1-32 µg/ml); Pseudomonas aeruginosa(MIC50=4 µg/ml); Pseudomonas aeruginosa(MIC90=16 µg/ml); Stenotrophomonas maltophilia(MIC=2-16 µg/ml); Achromobacter xylosoxidans(MIC=2-32 µg/ml).
    • [Ref.10768969]Gram-positive bacteria:Staphylococcus aureus ATCC 33591(MIC=1.24 µM ); Staphylococcus aureus ATCC 33591(100 mM NaCl,MIC=1.36 µM); Staphylococcus aureus 930918-3(MIC=0.41 µM); Staphylococcus aureus 930918-3(100 mM NaCl,MIC=0.63 µM);
    • Gram-negative bacteria:Pseudomonas aeruginosa PAO1(25 mM NaCl,EC50=0.22±0.05 µM); Pseudomonas aeruginosa PAO1(175 mM NaCl, EC50=0.11±0.02 µM); Escherichia coli DH5α(MIC=0.19 µM); Escherichia coli DH5α(100 mM NaCl, MIC=0.21 µM); Escherichia coli ML-35p(MIC=0.05 µM); Escherichia coli ML-35p(100 mM NaCl, MIC=0.09 µM); Pseudomonas aeruginosa PAO1(MIC=0.20 µM); Pseudomonas aeruginosa PAO1(100 mM NaCl, MIC=0.62 µM); Pseudomonas aeruginosa MR3007(MIC=0.05 µM); Pseudomonas aeruginosa MR3007(100 mM NaCl, MIC=0.36 µM).
    • [Ref.26656394]Gram-negative bacteria:Yersinia ruckeri 392/2003(MIC=2-4 µg/ml); Aeromonas salmonicida ATCC 49385(MIC=2 µg/ml); Salmonella enterica serovar Typhimurium LT2(MIC=4-8 µg/ml); Campylobacter jejuni NCTC 11168(MIC=1 µg/ml); Escherichia coli ATCC 25922(MIC=4-8 µg/ml ); Pseudomonas aeruginosa ATCC 27853(MIC=4-8 µg/ml); Escherichia coli BW25113(MIC=4-8 µg/ml); Escherichia coli BW25113 del-rfaC(MIC=4 µg/ml); Escherichia coli ATCC 25922 del-rfaC(MIC=2 µg/ml);
    • Gram-positive bacterial:Flavobacterium psychrophilum 1947(MIC>>256 µg/ml); Staphylococcus aureus ATCC 29213(MIC>=32 µg/ml); Enterococcus faecalis ATCC 29212(MIC=8 µg/ml); Listeria monocytogenes N22-2(MIC=2-4 µg/ml).
    • [Ref.30245684]Gram-negative bacterial:Escherichia coli ATCC 25922 del-waaC(MIC=2-4 µg/ml); Escherichia coli ATCC 25922 del-waaE(MIC=4 µg/ml); Escherichia coli ATCC 25922 del-waaF(MIC=2-4 µg/ml); Escherichia coli ATCC 25922 del-waaG(MIC=4 µg/ml); Escherichia coli JW3596(MIC=4 µg/ml); Escherichia coli JW1667(MIC=2-4 µg/ml ).
    • [Ref.29852015]Gram-negative bacterial:Aeromonas salmonicida ATCC 33658(MIC=4 µg/ml);
    • Gram-positive bacterial:Lactococcus lactis IL1403(MIC=1-2 µg/ml).

• • Hemolytic Activity

  • • [Ref.10768969]non-hemolysis against Human erythrocytes up to 500 µg/ml.
    • [Ref.26656394]1% hemolysis against Horse erythrocytes at 64 µg/ml.

• • Cytotoxicity

  • • Not found

• • Binding Target

  • liposomes

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Alpha helix

• • Structure Description

  • The peptide adopted an appreciable α-helical content in the presence of the organic cosolvent 40% trifluoroethanol and in the presence of 0.1% lipopolysaccharide.

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 1LYP

• Predicted Structure

• There is no predicted structure for DRAMP29099.

DRAMP29099

• • Function

  • Antibacterial activity against Gram-positive bacteria and Gram-negative bacteria.CAP18 were active against P. aeruginosa, E. coli, S. aureus, and MRSA.

• ·Literature 1

• • Title

  • Cathelicidin peptides inhibit multiply antibiotic-resistant pathogens from patients with cystic fibrosis.

• • Pubmed ID

  • 11557478

• • Reference

  • Antimicrob Agents Chemother. 2001 Oct;45(10):2838-2844.

• • Author

  • Saiman L, Tabibi S, Starner TD, San Gabriel P, Winokur PL, Jia HP, McCray PB Jr, Tack BF.

• ·Literature 2

• • Title

  • Bactericidal activity of mammalian cathelicidin-derived peptides.

• • Pubmed ID

  • 10768969

• • Reference

  • Infect Immun. 2000 May;68(5):2748-2755.

• • Author

  • Travis SM, Anderson NN, Forsyth WR, Espiritu C, Conway BD, Greenberg EP, McCray PB Jr, Lehrer RI, Welsh MJ, Tack BF.

• ·Literature 3

• • Title

  • Comparative Evaluation of the Antimicrobial Activity of Different Antimicrobial Peptides against a Range of Pathogenic Bacteria.

• • Pubmed ID

  • 26656394

• • Reference

  • PLoS One. 2015 Dec 11;10(12):e0144611.

• • Author

  • Ebbensgaard A, Mordhorst H, Overgaard MT, Nielsen CG, Aarestrup FM, Hansen EB.

• ·Literature 4

• • Title

  • The Role of Outer Membrane Proteins and Lipopolysaccharides for the Sensitivity of Escherichia coli to Antimicrobial Peptides.

• • Pubmed ID

  • 30245684

• • Reference

  • Front Microbiol. 2018 Sep 7;9:2153.

• • Author

  • Ebbensgaard A, Mordhorst H, Aarestrup FM, Hansen EB.

• ·Literature 5

• • Title

  • Dissection of the antimicrobial and hemolytic activity of Cap18: Generation of Cap18 derivatives with enhanced specificity.

• • Pubmed ID

  • 29852015

• • Reference

  • PLoS One. 2018 May 31;13(5):e0197742.

• • Author

  • Ebbensgaard A, Mordhorst H, Overgaard MT, Aarestrup FM, Hansen EB.