• • DRAMP ID

  • DRAMP29103

• • Peptide Name

  • PEW300

• • Source

  • Synthetic construct(Mutation of cecropin-A)

• • Family

  • Not found

• • Gene

  • N/A

• • Sequence

  • KWKLFKKIHKVGQNIRKGIIKAGPAVAVVGQAAQIAK

• • Sequence Length

  • 37

• • UniProt Entry

  • P01507

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial,Anti-Gram+, Anti-Gram-

• • Target Organism

  • • [Ref.30607494]Gram-positive bacteria:Staphylococcus aureus ATCC 6538(MIC=14.18 µg/ml); Staphylococcus aureus ATCC 6538(MBC=28.36 µg/ml); Bacillus megaterium ATCC 14945(MIC=7.09 µg/ml); Bacillus megaterium ATCC 14945(MBC=14.18 µg/ml); Bacillus licheniformis ATCC 14580(MIC=14.18 µg/ml); Bacillus licheniformis ATCC 14580(MBC=14.18 µg/ml); Staphylococcus epidermidis ATCC 12228(MIC=7.09 µg/ml); Staphylococcus epidermidis ATCC 12228(MBC=7.09 µg/ml);Bacillus cereus ATCC 10876(MIC=14.18 µg/ml);Bacillus cereus ATCC 10876(MBC=28.36 µg/ml);
    • Gram-negative bacteria:Escherichia coli ATCC 25922(MIC=7.09 µg/ml); Escherichia coli ATCC 25922(MBC=7.09 µg/ml); Pseudomonas aeruginosa ATCC 9027(MIC=14.18 µg/ml); Pseudomonas aeruginosa ATCC 9027(MBC=14.18 µg/ml); Stenotrophomonas maltophilia ATCC 51331(MIC=28.35 µg/ml); Stenotrophomonas maltophilia ATCC 51331(MBC=56.70 µg/ml); Pseudomonas otitidis MCC 10330(MIC=14.18 µg/ml); Pseudomonas otitidis MCC 10330(MBC=14.18 µg/ml); Klebsiella pneumoniae ATCC 35657(MIC=9.88 µg/ml); Klebsiella pneumoniae ATCC 35657(MBC=9.88 µg/ml); Salmonella enteritidis ATCC 9120(MIC=4.93 µg/ml); Salmonella enteritidis ATCC 9120(MBC=4.93 µg/ml).

• • Hemolytic Activity

  • • [Ref.30607494]non-hemolysis to Sheep erythrocytes up to 224 µg/ml.

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • liposomes

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Alpha helix(Predicted)

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP29103.

DRAMP29103

• • Function

  • Purified PEW300 exhibited strong antibacterial activity against various Gram-positive and Gram-negative bacteria.PEW300 had no hemolytic activity toward mammalian cells even at high concentration (224 ng/μl).It showed good stability in neutral and alkaline solutions. PEW300 was thermally stable even at up to 100 °C and resistant to proteinase K, pepsin, snailase, and trypsin.The incubation with human serum had no effect on the antibacterial activity of PEW300.

• ·Literature 1

• • Title

  • Design, expression, and characterization of a novel cecropin A-derived peptide with high antibacterial activity.

• • Pubmed ID

  • 30607494

• • Reference

  • Appl Microbiol Biotechnol. 2019 Feb;103(4):1765-1775.

• • Author

  • Wang M, Lin J, Sun Q, Zheng K, Ma Y, Wang J.