• • DRAMP ID

  • DRAMP29162

• • Peptide Name

  • EKL1C

• • Source

  • Synthetic construct

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • NVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYGSGC

• • Sequence Length

  • 40

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antiviral(SARS-CoV-2)

• • Target Organism

  • • [Ref.35087243]Virus:
    • SARS-CoV-2 Omicron:inhibition of cell-cell fusion in Calu-3 cells(IC50=12.18 nM);inhibition of cell-cell infusion in Caco2 cells(IC50=5.52 nM);inhibition of infection(Pseudovirus)(IC50=26.14 nM);inhibition of infection(Authentic)(IC50=182.2 nM);
    • SARS-CoV-2 Delta:inhibition of cell-cell fusion(IC50=14.42 nM);inhibition of infection(Pseudovirus)(IC50=31.99 nM);
    • SARS-CoV-2 D614G:inhibition of cell-cell fusion(IC50=11.77 nM);inhibition of infection(Pseudovirus)(IC50=23.6 nM).
    • [Ref.34367893]Virus:
    • SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.045±0.006 μmol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.037±0.009 μmol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.040±0.005 μmol/L),inhibition of cell-cell fusion(IC50=0.008±0.001 μmol/L);inhibited authentic SARS-CoV-2 infection in Vero E6 cells(IC50=0.003±0.001 μmol/L);
    • SARS-CoV-2 variants(inhibition of Pseudovirus(PsV) infection):V341L(IC50=0.047±0.013 μmol/L);F342L(IC50=0.026±0.007 μmol/L);V367F(IC50=0.066±0.012 μmol/L);R408I(IC50=0.148±0.012 μmol/L);N435D(IC50=0.135±0.013 μmol/L);G476S(IC50=0.065±0.008 μmol/L);V483A(IC50=0.078±0.011 μmol/L);N501Y(IC50=0.069±0.006 μmol/L);D614G(IC50=0.104±0.010 μmol/L);12 mutations(P.1)(IC50=0.046±0.006 μmol/L);K417N-E484K-N501Y(IC50=0.113±0.013 μmol/L);8 mutations(B.1.1.7)(IC50=0.120±0.009 μmol/L);wide type(IC50=0.049±0.007 μmol/L);
    • inhibition of multiple HCoV Pseudovirus:SARS-CoV (IC50=0.076±0.014 μmol/L), MERS-CoV(IC50=0.048±0.006 μmol/L), HCoV-OC43(IC50=0.668±0.081 μmol/L), HCoV-NL63(IC50=0.035±0.003 μmol/L), SARSr-CoV-WIV1(IC50=0.218±0.013 μmol/L), and HCoV-Rs3367 (IC50=0.046±0.003 μmol/L),inhibition of authentic HCoV-OC43 infection in RD cells (IC50=0.281±0.018 μmol/L).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • [Ref.34367893]Huh-7 cells:CC50=10 μmol/L;Caco-2 cells:CC50=13.81 μmol/L;293T/ACE2 cells:CC50=8.49 μmol/L.

• • Binding Target

  • liposomes

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Chol

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP29162.

DRAMP29162

• • EKL1C is a Peptide-based pan-CoV fusion inhibitor,targets a highly conserved target site in HR1 domains in S protein of HCoVs.

• ·Literature 1

• • Title

  • Peptide-based pan-CoV fusion inhibitors maintain high potency against SARS-CoV-2 Omicron variant.

• • Pubmed ID

  • 35087243

• • Reference

  • Cell Res. 2022 Apr;32(4):404-406.

• • Author

  • Xia S, Chan JF, Wang L, Jiao F, Chik KK, Chu H, Lan Q, Xu W, Wang Q, Wang C, Yuen KY, Lu L, Jiang S.

• ·Literature 2

• • Title

  • A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.

• • Pubmed ID

  • 34367893

• • Reference

  • Acta Pharm Sin B. 2021 Aug 2.

• • Author

  • Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.