• DRAMP ID

    • DRAMP29163
    • Peptide Name

    • EK1-C16
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG
    • Sequence Length

    • 41
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.35336956]Virus:
      • SARS-CoV-2 WT:inhibition of pseudovirus (PsV) infection in Caco2 cells(IC50=0.48 μM);
      • SARS-CoV-2 Alpha:inhibition of pseudovirus (PsV) infection(IC50=0.19 μM);
      • SARS-CoV-2 Beta:inhibition of pseudovirus (PsV) infection(IC50=0.43 μM);
      • SARS-CoV-2 Gamma:inhibition of pseudovirus (PsV) infection(IC50=0.26 μM);
      • SARS-CoV-2 Delta:inhibition of pseudovirus (PsV) infection(IC50=0.11 μM);
      • SARS-CoV-2 Omicron:inhibition of pseudovirus (PsV) infection(IC50=0.23 μM);inhibition of authentic infection in Vero-E6-TMPRSS-2 cells(IC50=0.75 μM);
      • SARS-CoV:inhibition of pseudovirus (PsV) infection(IC50=0.17 μM);
      • SARSr-CoV WIV1:inhibition of pseudovirus (PsV) infection(IC50=0.15 μM);
      • SARSr-CoV Rs3367:inhibition of pseudovirus (PsV) infection(IC50=0.3 μM);
      • MERS-CoV:inhibition of pseudovirus (PsV) infection in Caco2 cells(IC50=0.10 μM);inhibition of cell-cell fusion(IC50=0.012 μM);
      • HCoV-OC43:inhibition of authentic infection in RD cells(IC50=0.07 μM);inhibition of cell-cell fusion(IC50=0.01 μM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • [Ref.35336956]showed no significant cytotoxicity against RD cells at the concentration of 5 μM.
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • PEG4-C16(palmitic acid)
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29163 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29163.
    • Formula

    • C208H336N48O71S
    • Absent Amino Acids

    • CHPRW
    • Common Amino Acids

    • EL
    • Mass

    • 4677.29
    • PI

    • 4.36
    • Basic Residues

    • 5
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 13
    • Net Charge

    • -5
    • Boman Index

    • -6701
    • Hydrophobicity

    • -0.449
    • Aliphatic Index

    • 104.63
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 74.5
    • Polar Residues

    • 11

DRAMP29163

DRAMP29163 chydropathy plot
    • EK1-C16 at 0.31 μM could effectively inhibit authentic SARS-CoV-2 WT infection.

  • ·Literature 1
    • Title

    • A Palmitic Acid-Conjugated, Peptide-Based pan-CoV Fusion Inhibitor Potently Inhibits Infection of SARS-CoV-2 Omicron and Other Variants of Concern.
    • Reference

    • Viruses. 2022 Mar 6;14(3):549.
    • Author

    • Lan Q, Chan JF, Xu W, Wang L, Jiao F, Zhang G, Pu J, Zhou J, Xia S, Lu L, Yuen KY, Jiang S, Wang Q.