General Information

    • DRAMP ID

    • DRAMP29169

    • Peptide Name

    • EKL2C

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • TFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVGSGC

    • Sequence Length

    • 40

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.115±0.019 μmol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.054±0.014 μmol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.200±0.020 μmol/L),inhibition of cell-cell fusion(IC50=0.022±0.001 μmol/L).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • liposomes

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Chol

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29169 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29169.

Physicochemical Information

    • Formula

    • C216H331N45O70S2

    • Absent Amino Acids

    • HNPQRW

    • Common Amino Acids

    • E

    • Mass

    • 4742.38

    • PI

    • 4.39

    • Basic Residues

    • 5

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 11

    • Net Charge

    • -5

    • Boman Index

    • -5767

    • Hydrophobicity

    • -0.505

    • Aliphatic Index

    • 87.75

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7450

    • Absorbance 280nm

    • 191.03

    • Polar Residues

    • 13

DRAMP29169

DRAMP29169 chydropathy plot

Comments Information

    • The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs.

Literature Information

  • ·Literature 1

    • Title

    • A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.

    • Reference

    • Acta Pharm Sin B. 2021 Aug 2.

    • Author

    • Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.