General Information

    • DRAMP ID

    • DRAMP29176

    • Peptide Name

    • MBD-4 (11-40)(P9)

    • Source

    • Synthetic construct

    • Family

    • Belongs to the beta-defensin family.

    • Gene

    • Defb4

    • Sequence

    • NGAICWGPCPTAFRQIGNCGHFKVRCCKIR

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.32843628]Virus:
      • SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=2.4 µg/ml);
      • SARS-CoV:Inhibition of infection in Vero E6 cells(IC50=6.2 µg/ml);
      • MERS-CoV:Inhibition of infection in Vero E6 cells(IC50=8.8 µg/ml);
      • Human rhinovirus (HRV):inhibition of infection in RD cells(IC50=34 µg/ml);
      • Human parainfluenza virus 3:Inhibition of infection in LLC-MK2 cells(IC50>25 µg/ml);
      • Human Influenza A Virus H1N1:Inhibition of infection In MDCK cells(IC50=1.6 µg/ml);
      • Human Influenza A Virus H7N9:Inhibition of infection In MDCK cells(IC50=3.3 µg/ml).
      • [Ref.26911565]Virus:Human Influenza A Virus H1N1(IC50=1.2 µg/ml);Human Influenza A Virus H3N2(IC50=1.2 µg/ml);Human Influenza A Virus H5N1(IC50=2.4 µg/ml);Human Influenza A Virus H7N7(IC50=0.8 µg/ml);Human Influenza A Virus H7N9(IC50=4.6 µg/ml);MERS-CoV(IC50=4.8 µg/ml);SARS-CoV(IC50=4.8 µg/ml)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.26911565]Xytotoxicity against Madin-Darby canine kidney cells(TC50=380 μg/ml).

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29176 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP29176.

Physicochemical Information

    • Formula

    • C144H227N47O35S5

    • Absent Amino Acids

    • DELMSY

    • Common Amino Acids

    • C

    • Mass

    • 3336.98

    • PI

    • 9.41

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -4104

    • Hydrophobicity

    • -0.067

    • Aliphatic Index

    • 55.33

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 198.28

    • Polar Residues

    • 12

DRAMP29176

DRAMP29176 chydropathy plot

Comments Information

    • Mechanism of action

    • Mechanistic studies show that positively charged P9 broadly inhibits viral replication by binding to different viruses and then inhibits virus–host endosomal acidification to prevent the endosomal release of pH-dependent viruses.

Literature Information

  • ·Literature 1

    • Title

    • A novel peptide with potent and broad-spectrum antiviral activities against multiple respiratory viruses.

    • Reference

    • Sci Rep. 2016 Feb 25;6:22008.

    • Author

    • Zhao H, Zhou J, Zhang K, Chu H, Liu D, Poon VK, Chan CC, Leung HC, Fai N, Lin YP, Zhang AJ, Jin DY, Yuen KY, Zheng BJ.
  • ·Literature 2

    • Title

    • A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2.

    • Reference

    • Nat Commun. 2020 Aug 25;11(1):4252.

    • Author

    • Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KY.