General Information

    • DRAMP ID

    • DRAMP29177

    • Peptide Name

    • MBD-4 (11-40) (P9 [H21R,K23R,K28R], P9R)

    • Source

    • Synthetic construct

    • Family

    • Belongs to the beta-defensin family.

    • Gene

    • Defb5

    • Sequence

    • NGAICWGPCPTAFRQIGNCGRFRVRCCRIR

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.32843628]Virus:
      • SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=0.9 µg/ml);
      • SARS-CoV:Inhibition of infection in Vero E6 cells(IC50=4.2 µg/ml);
      • MERS-CoV:Inhibition of infection in Vero E6 cells(IC50=22 µg/ml);
      • Human rhinovirus (HRV):inhibition of infection in RD cells(IC50=5.7 µg/ml);
      • Human parainfluenza virus 3:Inhibition of infection in LLC-MK2 cells(IC50>25 µg/ml);
      • Human Influenza A Virus H1N1:Inhibition of infection In MDCK cells(IC50=0.6 µg/ml);
      • Human Influenza A Virus H7N9:Inhibition of infection In MDCK cells(IC50=0.9 µg/ml).

    • Hemolytic Activity

      • [Ref.32843628]P9R did not cause the hemolysis of Chicken red blood cells.

    • Cytotoxicity

      • [Ref.32843628]the CC50 of P9R was >300 μg/ml for MDCK, VeroE6 and A549 cells.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29177 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP29177.

Physicochemical Information

    • Formula

    • C144H232N52O35S5

    • Absent Amino Acids

    • DEHKLMSY

    • Common Amino Acids

    • R

    • Mass

    • 3412.05

    • PI

    • 10.46

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -7004

    • Hydrophobicity

    • -0.15

    • Aliphatic Index

    • 55.33

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 198.28

    • Polar Residues

    • 12

DRAMP29177

DRAMP29177 chydropathy plot

Comments Information

    • Mechanism of action

    • Mechanistic studies show that positively charged P9R broadly inhibits viral replication by binding to different viruses and then inhibits virus–host endosomal acidification to prevent the endosomal release of pH-dependent viruses.

Literature Information

  • ·Literature 1

    • Title

    • A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2.

    • Reference

    • Nat Commun. 2020 Aug 25;11(1):4252.

    • Author

    • Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KY.