General Information

    • DRAMP ID

    • DRAMP29191

    • Peptide Name

    • LCB3

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • NDDELHMLMTDLVYEALHFAKDEEIKKRVFQLFELADKAYKNNDRQKLEKVVEELKELLERLLS

    • Sequence Length

    • 64

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.32907861]Virus:SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=48.1 pM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29191 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29191.

Physicochemical Information

    • Formula

    • C346H556N90O106S2

    • Absent Amino Acids

    • CGPW

    • Common Amino Acids

    • L

    • Mass

    • 7736.88

    • PI

    • 4.94

    • Basic Residues

    • 13

    • Acidic Residues

    • 16

    • Hydrophobic Residues

    • 24

    • Net Charge

    • -3

    • Boman Index

    • -15515

    • Hydrophobicity

    • -0.663

    • Aliphatic Index

    • 103.59

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 47.3

    • Polar Residues

    • 7

DRAMP29191

DRAMP29191 chydropathy plot

Comments Information

    • Mechanism of action

    • The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding.

Literature Information

  • ·Literature 1

    • Title

    • De novo design of picomolar SARS-CoV-2 miniprotein inhibitors.

    • Reference

    • Science. 2020 Oct 23;370(6515):426-431.

    • Author

    • Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D.