• • DRAMP ID

  • DRAMP29200

• • Peptide Name

  • EK1-GSGSGC

• • Source

  • Synthetic construct

• • Family

  • Belongs to the betacoronaviruses spike protein family.

• • Gene

  • S

• • Sequence

  • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGC

• • Sequence Length

  • 42

• • UniProt Entry

  • Q8BB25

• • Protein Existence

  • Hemology

• • Biological Activity

  • Antimicrobial, Antiviral(SARS-CoV-2)

• • Target Organism

  • • [Ref.33082259]Virus:
    • SARS-CoV-2:ihibition of cell-cell fusion in 293T cells(IC50=293±60 nM,IC90>900 nM),inhibition of infection in Vero E6 cells(IC50~ 41 nM);
    • SARS-CoV-2_D614G:ihibition of cell-cell fusion in 293T cells(IC50=261±136 nM,IC90=892±100 nM);
    • SARS-CoV-2_S943P:ihibition of cell-cell fusion in 293T cells(IC50=286±104 nM,IC90>1000 nM);
    • SARS-CoV-2_S247R:ihibition of cell-cell fusion in 293T cells(IC50=194±107 nM,IC90=893±77 nM);
    • MERS-CoV:ihibition of cell-cell fusion in 293T cells(IC50>1000 nM,IC90>1000 nM),inhibition of infection in Vero E6 cells(IC50~ 2 nM);
    • SARS-CoV-1:ihibition of cell-cell fusion in 293T cells(IC50=36±5 nM,IC90>1000 nM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • [Ref.33082259]Human embryonic kidney HEK293T cells:<5% Cytotoxicity at 10 µM;Vero E6 cells:18% Cytotoxicity at 10 µM.

• • Binding Target

  • liposomes

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP29200.

DRAMP29200

• • Mechanism of action

  • The lipopeptide is derived from the C-terminal heptad repeat (HRC) domain of SARS-CoV-2 S that potently inhibits infection by SARS-CoV-2.

• ·Literature 1

• • Title

  • Inhibition of Coronavirus Entry In Vitro and Ex Vivo by a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain.

• • Pubmed ID

  • 33082259

• • Reference

  • mBio. 2020 Oct 20;11(5):e01935-20.

• • Author

  • Outlaw VK, Bovier FT, Mears MC, Cajimat MN, Zhu Y, Lin MJ, Addetia A, Lieberman NAP, Peddu V, Xie X, Shi PY, Greninger AL, Gellman SH, Bente DA, Moscona A, Porotto M.