General Information

    • DRAMP ID

    • DRAMP29211

    • Peptide Name

    • EK1P4HC

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG

    • Sequence Length

    • 41

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.34769299]Virus:
      • SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.8 μM);
      • SARS-CoV-2 B.1.1.7 (Alpha):inhibition of Pseudoviruse infection in Caco2 cells(IC50=2.28 μM);
      • SARS-CoV-2 B.1.351 (Beta):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.62 μM);
      • SARS-CoV-2 P.1 (Gamma):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.48 μM);
      • SARS-CoV-2 B.1.617.2 (Delta):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.11 μM);
      • HCoV-229E(Authentic):inhibition of infection in Caco2 cells(IC50=0.48 μM);
      • HCoV-OC43(Authentic):inhibition of infection in Caco2 cells(IC50=0.41 μM);
      • SARS-CoV:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.35 μM);
      • MERS-CoV:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.10 μM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 μM.

    • Binding Target

    • liposomes

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • PEG4-25-HC

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29211 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29211.

Physicochemical Information

    • Formula

    • C208H336N48O71S

    • Absent Amino Acids

    • CHPRW

    • Common Amino Acids

    • EL

    • Mass

    • 4677.29

    • PI

    • 4.36

    • Basic Residues

    • 5

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 13

    • Net Charge

    • -5

    • Boman Index

    • -6701

    • Hydrophobicity

    • -0.449

    • Aliphatic Index

    • 104.63

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 74.5

    • Polar Residues

    • 11

DRAMP29211

DRAMP29211 chydropathy plot

Comments Information

    • The peptide targets two different sites when mediating virus–cell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level.

Literature Information

  • ·Literature 1

    • Title

    • 25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses.

    • Reference

    • Int J Mol Sci. 2021 Nov 1;22(21):11869.

    • Author

    • Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S.