• DRAMP ID

    • DRAMP29230
    • Peptide Name

    • EK1V1
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELK
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.34344868]Virus:
      • SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=273.5±4.1 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=2672.1±384.5 nM);
      • SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=214.5±20.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=1790.8±363.2 nM);
      • SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=4370.3±719.7 nM);
      • MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=499.8±163.3 nM);
      • HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=487.2±41.3 nM);
      • HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=1255.6±453.3 nM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Chol
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • 39% α-helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 μM and incubated at 37 °C
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29230 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29230.
    • Formula

    • C202H329N45O65S
    • Absent Amino Acids

    • CGHPRW
    • Common Amino Acids

    • EL
    • Mass

    • 4460.16
    • PI

    • 4.53
    • Basic Residues

    • 6
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 13
    • Net Charge

    • -4
    • Boman Index

    • -6858
    • Hydrophobicity

    • -0.527
    • Aliphatic Index

    • 115.95
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 82.78
    • Polar Residues

    • 6

DRAMP29230

DRAMP29230 chydropathy plot
    • The peptide is a fusion inhibitor against SARS-CoV-2.

  • ·Literature 1
    • Title

    • SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses.
    • Reference

    • Signal Transduct Target Ther. 2021 Aug 3;6(1):294.
    • Author

    • Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y.