General Information

    • DRAMP ID

    • DRAMP29230

    • Peptide Name

    • EK1V1

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELK

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.34344868]Virus:
      • SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=273.5±4.1 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=2672.1±384.5 nM);
      • SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=214.5±20.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=1790.8±363.2 nM);
      • SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=4370.3±719.7 nM);
      • MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=499.8±163.3 nM);
      • HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=487.2±41.3 nM);
      • HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=1255.6±453.3 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • liposomes

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Chol

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • 39% α-helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 μM and incubated at 37 °C

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29230 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29230.

Physicochemical Information

    • Formula

    • C202H329N45O65S

    • Absent Amino Acids

    • CGHPRW

    • Common Amino Acids

    • EL

    • Mass

    • 4460.16

    • PI

    • 4.53

    • Basic Residues

    • 6

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 13

    • Net Charge

    • -4

    • Boman Index

    • -6858

    • Hydrophobicity

    • -0.527

    • Aliphatic Index

    • 115.95

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 82.78

    • Polar Residues

    • 6

DRAMP29230

DRAMP29230 chydropathy plot

Comments Information

    • The peptide is a fusion inhibitor against SARS-CoV-2.

Literature Information

  • ·Literature 1

    • Title

    • SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses.

    • Reference

    • Signal Transduct Target Ther. 2021 Aug 3;6(1):294.

    • Author

    • Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y.