General Information

    • DRAMP ID

    • DRAMP29231

    • Peptide Name

    • EK1V2

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.34344868]Virus:
      • SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.9±0.2 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=87.2±8.3 nM);
      • SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=0.5±0.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=106.5±5.4 nM);
      • SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=252±5.6 nM);
      • MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=1.1±0.3 nM);
      • HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=59.4±13.1 nM);
      • HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=503.3±20.9 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • liposomes

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • PEG8-K(Chol)

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • 68% α-helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 μM and incubated at 37°C

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29231 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29231.

Physicochemical Information

    • Formula

    • C196H317N43O64S

    • Absent Amino Acids

    • CGHPRW

    • Common Amino Acids

    • EL

    • Mass

    • 4331.98

    • PI

    • 4.36

    • Basic Residues

    • 5

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 13

    • Net Charge

    • -5

    • Boman Index

    • -6303

    • Hydrophobicity

    • -0.433

    • Aliphatic Index

    • 119.17

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 85.14

    • Polar Residues

    • 6

DRAMP29231

DRAMP29231 chydropathy plot

Comments Information

    • The peptide is a fusion inhibitor against SARS-CoV-2.

Literature Information

  • ·Literature 1

    • Title

    • SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses.

    • Reference

    • Signal Transduct Target Ther. 2021 Aug 3;6(1):294.

    • Author

    • Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y.