• • DRAMP ID

  • DRAMP29311

• • Peptide Name

  • HKU4-HR2P1

• • Source

  • Synthetic construct

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • GPNFAEISKINTTLLDLSDEMAMLLQEVVKQLNDSYI

• • Sequence Length

  • 37

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial,Antiviral

• • Target Organism

  • • [Ref.30646495]Virus:MERS-CoV:inhibition of cell-cell fusion between 293T cells and Huh-7 cells(IC50=1.09 μM);
    • MERS-CoV Q1020:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=2.15 μM);
    • MERS-CoV Q1020H:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=2.72 μM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • [Ref.30646495]No cytotoxicity against Huh-7 cells up to 100 μM.

• • Binding Target

  • membrane

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • α-helix

• • Structure Description

  • 10.5%-13.5% α-helix determined by circular dichroism (CD).

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP29311.

DRAMP29311

• • Mechanism

  • The peptide bind with HR1 of MERS-CoV and thus disrupting the process of MERS-6HB formation can inhibit virus–cell membrane fusion and abolish viral infection.

• ·Literature 1

• • Title

  • Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4.

• • Pubmed ID

  • 30646495

• • Reference

  • Viruses. 2019 Jan 14;11(1):56. doi: 10.3390/v11010056

• • Author

  • Xia S, Lan Q, Pu J, Wang C, Liu Z, Xu W, Wang Q, Liu H, Jiang S, Lu L.