General Information

    • DRAMP ID

    • DRAMP29312

    • Peptide Name

    • HKU4-HR2P2

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • EISKINTTLLDLSDEMAMLLQEVVKQLNDSYIDLKEL

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial,Antiviral

    • Target Organism

      • [Ref.30646495]Virus:MERS-CoV:inhibition of cell-cell fusion between 293T cells and Huh-7 cells(IC50=0.38 μM);
      • MERS-CoV Q1020:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=0.34 μM);
      • MERS-CoV Q1020H:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=0.44 μM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.30646495]No cytotoxicity against Huh-7 cells up to 100 μM.

    • Binding Target

    • membrane

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • α-helix

    • Structure Description

    • 10.5%-13.5% α-helix determined by circular dichroism (CD).

    • Helical Wheel Diagram

    • DRAMP29312 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29312.

Physicochemical Information

    • Formula

    • C187H314N44O64S2

    • Absent Amino Acids

    • CFGHPRW

    • Common Amino Acids

    • L

    • Mass

    • 4266.93

    • PI

    • 4.07

    • Basic Residues

    • 3

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 14

    • Net Charge

    • -5

    • Boman Index

    • -4990

    • Hydrophobicity

    • -0.024

    • Aliphatic Index

    • 134.32

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 41.39

    • Polar Residues

    • 8

DRAMP29312

DRAMP29312 chydropathy plot

Comments Information

    • Mechanism

    • The peptide bind with HR1 of MERS-CoV and thus disrupting the process of MERS-6HB formation can inhibit virus–cell membrane fusion and abolish viral infection.

Literature Information

  • ·Literature 1

    • Title

    • Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4.

    • Reference

    • Viruses. 2019 Jan 14;11(1):56. doi: 10.3390/v11010056

    • Author

    • Xia S, Lan Q, Pu J, Wang C, Liu Z, Xu W, Wang Q, Liu H, Jiang S, Lu L.