General Information

    • DRAMP ID

    • DRAMP37283

    • Peptide Name

    • SPC13

    • Source

    • Scolopendra Polymorpha

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIXRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR

    • Sequence Length

    • 109

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus ATCC 29212 (MIC=45 µM);
      • Gram-negative bacteria: Pseudomonas aeruginosa (MIC=192.5 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Predicted Structure

    • There is no predicted structure for DRAMP37283.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial Activity of SPC13, New Antimicrobial Peptide Purified from Scolopendra polymorpha Venom

    • doi

    • 10.2174/2211352517666190531110829

    • Reference

    • Anti-Infective Agents. 2020. PP 233-238

    • Author

    • Rodríguez-Alejandro, Gutiérrez M.C.