-
-
-
Sequence
- TIEEQAKTⓍLDKⓍNHEAEDLFYQⓍSLAⓍWN
-
-
Original Sequence
- TIEEQAKTFLDKFNHEAEDLFYQSSLASWN
-
Source
- Synthetic construct
-
-
-
Biological Activity
- Antimicrobial, Antiviral(SARS-CoV-2)
-
- Mechanism of action:The stapled peptide designed based on the ACE2 helix, which is expected to bind to SARS-CoV-2 and prevent the binding of the virus to the ACE2 receptor and disrupt the infection.
-
Target Organism
-
- [Ref.33310780]Virus:
- SARS-CoV-2:Inhibition of infection in HT1080/ACE2 cells(IC50=4.1 ± 0.26 μM);Inhibition of infection in A549/ACE2 cells(IC50=2.2 ± 0.14 μM);Inhibition of virus-induced cytopathic effect (CPE) in Vero E6 cells(IC100=17.2 μM);
- VSV-G:Inhibition of infection in HT1080/ACE2 cells(IC50>27.5 μM);Inhibition of infection in A549/ACE2 cells(IC50>27.5 μM).
-
Hemolytic Activity
-
- No hemolytic activity information found.
-
Cytotoxicity
-
- [Ref.33310780]HT1080/ACE2 cells:CC50>27.5 μM(Less than 10% toxicity at this dose);A549/ACE2 cells:CC50>27.5 μM(Less than 10% toxicity at this dose).
-
Linear/Cyclic
- Cyclic (Stapled)
-
N-terminal Modification
- Acylation
-
C-terminal Modification
- Amidation
-
Special Amino Acid and Stapling Position
- ①The Ⓧ (position: 9,13,24 and 28) in sequence indicate S-2-(4'-pentenyl) alanine.② Ⓧ(9) and Ⓧ(13), Ⓧ(24) and Ⓧ(28) are cross-linked by hydrocarbon stapling.
-
-
Secondary Structure
- 94% α-helical content in 10 mM phosphate-buffered saline (PBS)
-
Structure Description
- No other descriptive information about the structure found in the literature
-
There is no predicted structure for DRAMP29235.
- Literature 1
-
Title
- Stapled Peptides Based on Human Angiotensin-Converting Enzyme 2 (ACE2) Potently Inhibit SARS-CoV-2 Infection In Vitro.
-
-
Reference
- mBio. 2020 Dec 11;11(6):e02451-20.
-
Author
- Curreli F, Victor SMB, Ahmed S, Drelich A, Tong X, Tseng CK, Hillyer CD, Debnath AK.