General Information

    • DRAMP ID

    • DRAMP29237

    • Peptide Name

    • NYBSP-3

    • Sequence

    • TIEEQAKTⓍLDKⓍNHEAEDLⓏYQSSLAⓍWN

    • Sequence Length

    • 30

    • Original Sequence

    • TIEEQAKTFLDKFNHEAEDLFYQSSLASWN

    • Source

    • Synthetic construct

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Comments

    • Mechanism of action:The stapled peptide designed based on the ACE2 helix, which is expected to bind to SARS-CoV-2 and prevent the binding of the virus to the ACE2 receptor and disrupt the infection.

    • Target Organism

      • [Ref.33310780]Virus:
      • SARS-CoV-2:Inhibition of infection in HT1080/ACE2 cells(IC50=12.9 ± 0.35 μM);Inhibition of infection in A549/ACE2 cells(IC50~25 μM);
      • VSV-G:Inhibition of infection in HT1080/ACE2 cells(IC50>27.6 μM);Inhibition of infection in A549/ACE2 cells(IC50>27.6 μM).

    • Hemolytic Activity

      • No hemolytic activity information found.

    • Cytotoxicity

      • [Ref.33310780]HT1080/ACE2 cells:CC50>27.6 μM(Less than 10% toxicity at this dose);A549/ACE2 cells:CC50>27.6 μM(Less than 10% toxicity at this dose).

Structure Information

    • Linear/Cyclic

    • Cyclic (Stapled)

    • N-terminal Modification

    • Acylation

    • C-terminal Modification

    • Amidation

    • Special Amino Acid and Stapling Position

    • ①The Ⓧ (position: 9,13 and 28) in sequence indicate S-2-(4'-pentenyl) alanine.②The Ⓩ (position: 21) indicates 2-(7'-octenyl) alanine in the R configuration.③ Ⓧ(9) and Ⓧ(13), Ⓩ(21) and Ⓧ(28) are cross-linked by hydrocarbon stapling.

    • Stereochemistry

    • L

    • Secondary Structure

    • 50% α-helical content in 10 mM phosphate-buffered saline (PBS)

    • Structure Description

    • No other descriptive information about the structure found in the literature

    • Helical Wheel Diagram

    • DRAMP29237 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP29237.

Literature Information

  • Literature 1

    • Title

    • Stapled Peptides Based on Human Angiotensin-Converting Enzyme 2 (ACE2) Potently Inhibit SARS-CoV-2 Infection In Vitro.

    • Reference

    • mBio. 2020 Dec 11;11(6):e02451-20.

    • Author

    • Curreli F, Victor SMB, Ahmed S, Drelich A, Tong X, Tseng CK, Hillyer CD, Debnath AK.