• DRAMP ID

    • DRAMP29239
    • Peptide Name

    • hACE2(21-55)A36K-F40E
    • Sequence

    • IEEQAKTFLDKFNHEⓀEDLⒺYQSSLASWNYNTNIT
    • Sequence Length

    • 35
    • Original Sequence

    • IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNIT
    • Source

    • Synthetic construct
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Comments

    • Mechanism of action:The stapled peptide inhibit the RBD-hACE2 complex formation, and hACE2 α1-helix-based peptidomimetics could potentially prevent SARS-CoV-2 from entering the human cells through hACE2 and thus inhibit subsequent viral replication.
    • Target Organism

      • [Ref.33651072]Virus:SARS-CoV-2:inhibition of SARS-CoV-2 Spike protein-hACE2 complex formation(IC50=3.6 μM).
    • Hemolytic Activity

      • No hemolytic activity information found.
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Linear/Cyclic

    • Cyclic (Stapled)
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Special Amino Acid and Stapling Position

    • Ⓚ (16) and Ⓔ (20) are corss-linked by lactam stapling.
    • Stereochemistry

    • L
    • Secondary Structure

    • ①52% α-helical content in 10 mM PBS at pH 7.4 with 30% TFE at 298 K.②6-13% α-helical content in 10 mM PBS at pH 7.4 and 298 K.
    • Structure Description

    • Low helicity for stapled hACE2 peptides in absence of TFE, with predictors of helicity averaging to 6-13% helical content. In the presence of TFE, α-helical structures can be observed for various synthetic hACE2 peptides with predictors averaging from 11 to 52% helical content
    • Helical Wheel Diagram

    • DRAMP29239 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP29239.
  • Literature 1
    • Title

    • Targeting SARS-CoV-2 spike protein by stapled hACE2 peptides.
    • Reference

    • Chem Commun (Camb). 2021 Apr 4;57(26):3283-3286.
    • Author

    • Maas MN , Hintzen JCJ , Löffler PMG , Mecinović J .