General Information

    • DRAMP ID

    • DRAMP29865

    • Peptide Name

    • T-2410

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL

    • Sequence Length

    • 38

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

      • Virus: HIV type 1

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Stability Information

    • Serum or Protease Type

    • Monkey serum

    • Stability Data

    • Half-life is 1.2h.

    • Assay

    • RP-HPLC

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29865.

Literature Information

  • ·Literature 1

    • Title

    • Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

    • Reference

    • Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7.

    • Author

    • Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.