• DRAMP ID

    • DRAMP29868
    • Peptide Name

    • T-2544
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MTWEAWDRAIAEYAARIEALIRAAQEQQEKNEAALREL
    • Sequence Length

    • 38
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral
    • Target Organism

      • Virus: HIV type 1
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Serum or Protease Type

    • Monkey serum
    • Stability Data

    • Half-life is 5.1h.
    • Assay

    • RP-HPLC
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29868.
  • ·Literature 1
    • Title

    • Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.
    • Reference

    • Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7.
    • Author

    • Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.