• DRAMP ID

    • DRAMP29909
    • Peptide Name

    • RMP-16 (Recombinant slow-release TNF α-derived peptide)
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MWQRPSSWIEGRLLTHTISRIAVSYQTKVNLL
    • Sequence Length

    • 32
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Anti-cancer
    • Target Organism

    • Not available
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Serum or Protease Type

    • Rat plasma
    • Stability Data

    • The half-life is 15.83h.
    • Assay

    • LC/MS
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29909.
  • ·Literature 1
    • Title

    • A novel recombinant slow-release TNF α-derived peptide effectively inhibits tumor growth and angiogensis.
    • Reference

    • Sci Rep. 2015 Sep 4;5:13595.
    • Author

    • Ma Y, Zhao S, Shen S, Fang S, Ye Z, Shi Z, Hong A