• DRAMP ID

    • DRAMP18080
    • Name

    • Plectasin
    • Sequence

    • GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
    • Description

    • fungal defensin
    • Activity

    • Antibacterial
    • Target Organism

      • No MICs found on DRAMP database
    • Reference

      • Antimicrobial peptides: therapeutic potential. Expert Opin. Pharmacother. (2006).
      • Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus. Nature (2005).(PMID: 16222292)
    • Medical use

    • Systemic anti–Gram positive,especially pneumococcal and streptococcal infections
    • Company

    • Novozymes A/S(Bagsvaerd, Denmark)
    • Stage of Development

    • Phase I
    • Comments

    • Plectasin has exhibited low toxicity in mice and demonstrated efficacy in both bacterial peritonitis and pneumonia models. Unlike other clinically tested AMPs, plectasin can be tolerated at high doses and, therefore, can be administered intravenously for the treatment of systemic infections
    • Clinical Trials