• DRAMP ID

    • DRAMP18173
    • Sequence

    • KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC
    • Sequence Name

    • Pediocin PA-1 (Bacteriocin)
    • Description

    • Pediococcus acidilactici UL5
    • Activity

    • Antibacterial
    • Medical use

    • Gastrointestinal tract infections; Stomach and intestine infections (Murine model; In-vivo)
    • Stage of Development

    • Preclinical
    • Comments

    • No more comments
    • Company

    • Unknown
    • Target Organism

      • No MICs found on DRAMP database
    • Reference

      • In vivo study on the effectiveness of pediocin PA-1 and Pediococcus acidilactici UL5 at inhibiting Listeria monocytogenes. (PMID: 19541383)