Sequence Information

    • DRAMP ID

    • DRAMP18173

    • Name

    • Pediocin PA-1 (Bacteriocin)

    • Sequence

    • KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC

    • Description

    • Pediococcus acidilactici UL5

    • Activity

    • Antibacterial

    • Target Organism

      • No MICs found on DRAMP database

    • Reference

      • In vivo study on the effectiveness of pediocin PA-1 and Pediococcus acidilactici UL5 at inhibiting Listeria monocytogenes. (PMID: 19541383)

Clinical Information

    • Medical use

    • Gastrointestinal tract infections; Stomach and intestine infections (Murine model; In-vivo)

    • Company

    • Unknown

    • Stage of Development

    • Preclinical

    • Comments

    • No more comments

    • Clinical Trials