-
-
Sequence
- MARCLKSCSVHGLWLLSMILLASCVVHAHIINGRQSNTGSLTMTTTGEASMIIGDEKDAICYIKAALYCCKRTIQCYQDIAQCLRNCRKNV
-
-
Sequence Name
- Sequence 22 from Patent US 20030028921
-
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2003-2-6
-
-
Patent Title
- Maize basal layer antimicrobial protein polynucleotides and method of use.
-
Abstract
- Methods and compositions for modulating development and defense response are provided. Nucleotide sequences encoding maize BTL proteins are provided. The sequence can be used in expression cassettes for antimicrobial resistance, modulating development, developmental pathways, and defense response. Transformed plants, plant cells, tissues, and seed are also provided.