-
-
Sequence
- MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG
-
-
Sequence Name
- Sequence 7 from Patent US 20030092612
-
Source
- Synthetic construct
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2003-5-15
-
-
Patent Title
- Use of antimicrobial peptides as preservatives in ophthalmic preparations, including solutions, emulsions, and suspensions.
-
Abstract
- Methods for preserving ophthalmic compositions are disclosed. In one embodiment, such compositions include a liquid medium and an antimicrobial component which is preferably substantially non-oxidative. Compositions which include a liquid medium and antimicrobial peptide magainins, present in an amount effective as a preservative, are also disclosed. Preserved compositions useful for administering a therapeutic component to the eyes or caring for contact lenses are also included within the scope of the present invention.