-
-
Sequence
- DVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDS
-
-
Sequence Name
- Sequence 11 from Patent US 20040037781
-
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2004-2-26
-
-
Patent Title
- Peptides with antioxidant and antimicrobial properties.
-
Abstract
- Methods of treating conditions associated with lipid oxidation or microbial proliferation include the step of administering a composition comprising a pharmacologically effective amount of an antioxidant or antimicrobial lung surfactant protein compound. Peptides derived from lung surfactant protein compounds possess lipid oxidation inhibiting and/or antimicrobial properties.