• DRAMP ID

    • DRAMP08703
    • Sequence

    • ATCDLLSGIGVQHSACALHCVFRGNRGGYCTGKGICVCRN
    • Sequence Length

    • 40
    • Sequence Name

    • Sequence 75 from Patent US 20080269122
    • Source

    • Sarcophaga peregrina
    • Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Patent Type

    • Patent Application
    • Publication Date

    • 2008-10-30
    • Patent Title

    • Antimicrobial Peptides Derived From Cap18.
    • Abstract

    • The present invention relates to retroviral constructs that encode novel monoclonal antibodies, novel fusion proteins, and chimeric monoclonal antibodies and to methods of using and producing the same. In particular, the present invention relates to methods of producing a fusion protein comprising a microorganism targeting molecule (e.g., immunoglobulin or innate immune system receptor molecule) and a biocide (e.g., bactericidal enzymes) in transgenic animals (e.g., bovines) and in cell cultures. The present invention also relates to therapeutic and prophylactic methods of using a fusion protein comprising a microorganism targeting molecule and a biocide in health care (e.g., human and veterinary), agriculture (e.g., animal and plant production), and food processing (e.g., beef carcass processing). The present invention also relates to methods of using a fusion protein comprising a microorganism targeting molecule and a biocide in various diagnostic applications in number of diverse fields such as